PTPN14 monoclonal antibody (M01), clone 4F7
  • PTPN14 monoclonal antibody (M01), clone 4F7

PTPN14 monoclonal antibody (M01), clone 4F7

Ref: AB-H00005784-M01
PTPN14 monoclonal antibody (M01), clone 4F7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PTPN14.
Información adicional
Size 100 ug
Gene Name PTPN14
Gene Alias MGC126803|PEZ|PTP36
Gene Description protein tyrosine phosphatase, non-receptor type 14
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq KQNKICTEQSNSPPPIRRQPTWSRSSLPRQQPYILPPVHVQCGEHYSETHTSQDSIFHGNEEALYCNSHNSLDLNYLNGTVTNGSVCSVHSVNSLNCSQSFIQASPVSSN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PTPN14 (NP_005392.2, 303 a.a. ~ 412 a.a) partial recombinant protein with GST-pstS1 tag.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5784
Clone Number 4F7
Iso type IgG2a Kappa

Enviar uma mensagem


PTPN14 monoclonal antibody (M01), clone 4F7

PTPN14 monoclonal antibody (M01), clone 4F7