PTPN1 MaxPab rabbit polyclonal antibody (D01)
  • PTPN1 MaxPab rabbit polyclonal antibody (D01)

PTPN1 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00005770-D01
PTPN1 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PTPN1 protein.
Información adicional
Size 100 uL
Gene Name PTPN1
Gene Alias PTP1B
Gene Description protein tyrosine phosphatase, non-receptor type 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVLLEMRK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PTPN1 (NP_002818.1, 1 a.a. ~ 435 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 5770

Enviar uma mensagem


PTPN1 MaxPab rabbit polyclonal antibody (D01)

PTPN1 MaxPab rabbit polyclonal antibody (D01)