PTMS monoclonal antibody (M10), clone 2D3
  • PTMS monoclonal antibody (M10), clone 2D3

PTMS monoclonal antibody (M10), clone 2D3

Ref: AB-H00005763-M10
PTMS monoclonal antibody (M10), clone 2D3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PTMS.
Información adicional
Size 100 ug
Gene Name PTMS
Gene Alias ParaT
Gene Description parathymosin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq MSEKSVEAAAELSAKDLKEKKEKVEEKASRKERKKEVVEEEENGAEEEEEETAEDGEEEDEGEEEDEEEEEEDDEGPALKRAAEEEDEADPKRQKTENGASA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PTMS (AAH17025, 1 a.a. ~ 102 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5763
Clone Number 2D3
Iso type IgG2a Kappa

Enviar uma mensagem


PTMS monoclonal antibody (M10), clone 2D3

PTMS monoclonal antibody (M10), clone 2D3