PTHR1 polyclonal antibody (A02)
  • PTHR1 polyclonal antibody (A02)

PTHR1 polyclonal antibody (A02)

Ref: AB-H00005745-A02
PTHR1 polyclonal antibody (A02)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PTHR1.
Información adicional
Size 50 uL
Gene Name PTH1R
Gene Alias MGC138426|MGC138452|PTHR|PTHR1
Gene Description parathyroid hormone 1 receptor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq DADDVMTKEEQIFLLHRAQAQCEKRLKEVLQRPASIMESDKGWTSASTSGKPRKDKASGKLYPESEEDKEAPTGSRYRGRPCLPEWDHILCWPLGAPGEVVAVPCPDY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PTHR1 (NP_000307, 27 a.a. ~ 134 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5745

Enviar uma mensagem


PTHR1 polyclonal antibody (A02)

PTHR1 polyclonal antibody (A02)