PTGS2 purified MaxPab mouse polyclonal antibody (B01P)
  • PTGS2 purified MaxPab mouse polyclonal antibody (B01P)

PTGS2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00005743-B01P
PTGS2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PTGS2 protein.
Información adicional
Size 50 ug
Gene Name PTGS2
Gene Alias COX-2|COX2|GRIPGHS|PGG/HS|PGHS-2|PHS-2|hCox-2
Gene Description prostaglandin-endoperoxide synthase 2 (prostaglandin G/H synthase and cyclooxygenase)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,IF
Immunogen Prot. Seq MLARALLLCAVLALSHTANPCCSHPCQNRGVCMSVGFDQYKCDCTRTGFYGENCSTPEFLTRIKLFLKPTPNTVHYILTHFKGFWNVVNNIPFLRNAIMSYVLTSRSHLIDSPPTYNADYGYKSWEAFSNLSYYTRALPPVPDDCPTPLGVKGKKQLPDSNEIVEKLLLRRKFIPDPQGSNMMFAFFAQHFTHQFFKTDHKRGPAFTNGLGHGVDLNHIYGETLARQRKLRLFKDGKMKYQIIDGEMYPPTVKDT
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PTGS2 (NP_000954.1, 1 a.a. ~ 604 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5743

Enviar uma mensagem


PTGS2 purified MaxPab mouse polyclonal antibody (B01P)

PTGS2 purified MaxPab mouse polyclonal antibody (B01P)