AB-H00005741-M17
New product
This product is no longer in stock
Availability date:
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Size | 100 ug |
Gene Name | PTH |
Gene Alias | PTH1 |
Gene Description | parathyroid hormone |
Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
Application Key | WB-Tr,ELISA |
Immunogen Prot. Seq | SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ |
Antigen species Target species | Human |
Quality control testing | Antibody Reactive Against Recombinant Protein. |
Immunogen | PTH (NP_000306, 32 a.a.-115 a.a.) full-length recombinant protein. |
Storage Buffer | In 1x PBS, pH 7.4 |
Gene ID | 5741 |
Clone Number | 3H7 |
Iso type | IgG1 Kappa |