View larger
Mouse monoclonal antibody raised against a full-length recombinant PTH.
AB-H00005741-M17
New product
PTH monoclonal antibody (M17), clone 3H7
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | PTH |
| Gene Alias | PTH1 |
| Gene Description | parathyroid hormone |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Tr,ELISA |
| Immunogen Prot. Seq | SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | PTH (NP_000306, 32 a.a.-115 a.a.) full-length recombinant protein. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 5741 |
| Clone Number | 3H7 |
| Iso type | IgG1 Kappa |
More info
Mouse monoclonal antibody raised against a full-length recombinant PTH.