PTH monoclonal antibody (M15), clone 3C5
  • PTH monoclonal antibody (M15), clone 3C5

PTH monoclonal antibody (M15), clone 3C5

Ref: AB-H00005741-M15
PTH monoclonal antibody (M15), clone 3C5

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant PTH.
Información adicional
Size 100 ug
Gene Name PTH
Gene Alias PTH1
Gene Description parathyroid hormone
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,ELISA
Immunogen Prot. Seq SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PTH (NP_000306, 32 a.a.-115 a.a.) full-length recombinant protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5741
Clone Number 3C5
Iso type IgG1 Kappa

Enviar uma mensagem


PTH monoclonal antibody (M15), clone 3C5

PTH monoclonal antibody (M15), clone 3C5