PTH polyclonal antibody (A01)
  • PTH polyclonal antibody (A01)

PTH polyclonal antibody (A01)

Ref: AB-H00005741-A01
PTH polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PTH.
Información adicional
Size 50 uL
Gene Name PTH
Gene Alias PTH1
Gene Description parathyroid hormone
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PTH (NP_000306, 32 a.a. ~ 115 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5741

Enviar uma mensagem


PTH polyclonal antibody (A01)

PTH polyclonal antibody (A01)