PTGIS polyclonal antibody (A01)
  • PTGIS polyclonal antibody (A01)

PTGIS polyclonal antibody (A01)

Ref: AB-H00005740-A01
PTGIS polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PTGIS.
Información adicional
Size 50 uL
Gene Name PTGIS
Gene Alias CYP8|CYP8A1|MGC126858|MGC126860|PGIS|PTGI
Gene Description prostaglandin I2 (prostacyclin) synthase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq PQRDPEIYTDPEVFKYNRFLNPDGSEKKDFYKDGKRLKNYNMPWGAGHNHCLGRSYAVNSIKQFVFLVLVHLDLELINADVEIPEFDLSRYGFGLMQPEHDVPVRYRIRP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PTGIS (NP_000952, 391 a.a. ~ 500 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5740

Enviar uma mensagem


PTGIS polyclonal antibody (A01)

PTGIS polyclonal antibody (A01)