PTGER4 polyclonal antibody (A01)
  • PTGER4 polyclonal antibody (A01)

PTGER4 polyclonal antibody (A01)

Ref: AB-H00005734-A01
PTGER4 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PTGER4.
Información adicional
Size 50 uL
Gene Name PTGER4
Gene Alias EP4|EP4R|MGC126583
Gene Description prostaglandin E receptor 4 (subtype EP4)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq SFISRELKEISSTSQTLLPDLSLPDLSENGLGGRNLLPGVPGMGLAQEDTTSLRTLRISETSDSSQGQDSESVLLVDEAGGSGRAGPAPKGSSLQVTFPSETLNLSEKCI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PTGER4 (NP_000949, 379 a.a. ~ 488 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5734

Enviar uma mensagem


PTGER4 polyclonal antibody (A01)

PTGER4 polyclonal antibody (A01)