PTCH monoclonal antibody (M04), clone 8A10 View larger

Mouse monoclonal antibody raised against a partial recombinant PTCH.

AB-H00005727-M04

New product

PTCH monoclonal antibody (M04), clone 8A10

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name PTCH1
Gene Alias BCNS|FLJ26746|FLJ42602|HPE7|NBCCS|PTC|PTC1|PTCH|PTCH11
Gene Description patched homolog 1 (Drosophila)
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq PKMWLHYFRDWLQGLQDAFDSDWETGKIMPNNYKNGSDDGVLAYKLLVQTGSRDKPIDISQLTKQRLVDADGIINPSAFYIYLTAWVSNDPVAYAASQAN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PTCH (NP_000255, 841 a.a. ~ 940 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5727
Clone Number 8A10
Iso type IgG2a Kappa

More info

Mouse monoclonal antibody raised against a partial recombinant PTCH.

Enviar uma mensagem

Mouse monoclonal antibody raised against a partial recombinant PTCH.

Mouse monoclonal antibody raised against a partial recombinant PTCH.