PSPH monoclonal antibody (M06), clone 3C1
  • PSPH monoclonal antibody (M06), clone 3C1

PSPH monoclonal antibody (M06), clone 3C1

Ref: AB-H00005723-M06
PSPH monoclonal antibody (M06), clone 3C1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PSPH.
Información adicional
Size 100 ug
Gene Name PSPH
Gene Alias PSP
Gene Description phosphoserine phosphatase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MVSHSELRKLFYSADAVCFDVDSTVIREEGIDELAKICGVEDAVSEMTRRAMGGAVPFKAALTERLALIQPSREQVQRLIAEQPPHLTPGIRELVSRLQE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PSPH (NP_004568, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5723
Clone Number 3C1
Iso type IgG2a Kappa

Enviar uma mensagem


PSPH monoclonal antibody (M06), clone 3C1

PSPH monoclonal antibody (M06), clone 3C1