PSPH monoclonal antibody (M01), clone 3A5
  • PSPH monoclonal antibody (M01), clone 3A5

PSPH monoclonal antibody (M01), clone 3A5

Ref: AB-H00005723-M01
PSPH monoclonal antibody (M01), clone 3A5

Información del producto

Mouse monoclonal antibody raised against a full length recombinant PSPH.
Información adicional
Size 50 ug
Gene Name PSPH
Gene Alias PSP
Gene Description phosphoserine phosphatase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MVSHSELRKLFYSADAVCFDVDSTVIREEGIDELAKICGVEDAVSEMTRRAMGGAVPFKAALTERLALIQPSREQVQRLIAEQPPHLTPGIRELVSRLQERNVQVFLISGGFRSIVEHVASKLNIPATNVFANRLKFYFNGEYAGFDETQPTAESGGKGKVIKLLKEKFHFKKIIMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFVELLGELEE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PSPH (AAH63614, 1 a.a. ~ 225 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5723
Clone Number 3A5
Iso type IgG2b Kappa

Enviar uma mensagem


PSPH monoclonal antibody (M01), clone 3A5

PSPH monoclonal antibody (M01), clone 3A5