PSMD12 polyclonal antibody (A01)
  • PSMD12 polyclonal antibody (A01)

PSMD12 polyclonal antibody (A01)

Ref: AB-H00005718-A01
PSMD12 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PSMD12.
Información adicional
Size 50 uL
Gene Name PSMD12
Gene Alias MGC75406|Rpn5|p55
Gene Description proteasome (prosome, macropain) 26S subunit, non-ATPase, 12
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq GEKRWKDLKNRVVEHNIRIMAKYYTRITMKRMAQLLDLSVDESEAFLSNLVVNKTIFAKVDRLAGIINFQRPKDPNNLLNDWSQKLNSLMSLVNKTTHLIAKEEMIHNLQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PSMD12 (NP_002807, 347 a.a. ~ 456 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5718

Enviar uma mensagem


PSMD12 polyclonal antibody (A01)

PSMD12 polyclonal antibody (A01)