PSMD1 polyclonal antibody (A01)
  • PSMD1 polyclonal antibody (A01)

PSMD1 polyclonal antibody (A01)

Ref: AB-H00005707-A01
PSMD1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PSMD1.
Información adicional
Size 50 uL
Gene Name PSMD1
Gene Alias MGC133040|MGC133041|P112|Rpn2|S1
Gene Description proteasome (prosome, macropain) 26S subunit, non-ATPase, 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MITSAAGIISLLDEDEPQLKEFALHKLNAVVNDFWAEISESVDKIEVLYEDEGFRSRQFAALVASKVFYHLGAFEESLNYALGAGDLFNVNDNSEYVETIIAKCIDHYTK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PSMD1 (NP_002798, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5707

Enviar uma mensagem


PSMD1 polyclonal antibody (A01)

PSMD1 polyclonal antibody (A01)