PSMC6 polyclonal antibody (A01)
  • PSMC6 polyclonal antibody (A01)

PSMC6 polyclonal antibody (A01)

Ref: AB-H00005706-A01
PSMC6 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PSMC6.
Información adicional
Size 50 uL
Gene Name PSMC6
Gene Alias CADP44|MGC12520|P44|SUG2|p42
Gene Description proteasome (prosome, macropain) 26S subunit, ATPase, 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LRPGRLDRKIHIDLPNEQARLDILKIHAGPITKHGEIDYEAIVKLSDGFNGADLRNVCTEAGMFAIRADHDFVVQEDFMKAVRKVADSKKLESKLDYKPV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PSMC6 (AAH05390, 290 a.a. ~ 389 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5706

Enviar uma mensagem


PSMC6 polyclonal antibody (A01)

PSMC6 polyclonal antibody (A01)