PSMC3 monoclonal antibody (M01), clone 1B9
  • PSMC3 monoclonal antibody (M01), clone 1B9

PSMC3 monoclonal antibody (M01), clone 1B9

Ref: AB-H00005702-M01
PSMC3 monoclonal antibody (M01), clone 1B9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PSMC3.
Información adicional
Size 100 ug
Gene Name PSMC3
Gene Alias MGC8487|TBP1
Gene Description proteasome (prosome, macropain) 26S subunit, ATPase, 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MNLLPNIESPVTRQEKMATVWDEAEQDGIGEEVLKMSTEEIIQRTRLLDSEIKIMKSEVLRVTHELQAMKDKIKENSEKIKVNKTLPYLVSNVIELLDVD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PSMC3 (AAH08713, 53 a.a. ~ 152 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5702
Clone Number 1B9
Iso type IgG1 Kappa

Enviar uma mensagem


PSMC3 monoclonal antibody (M01), clone 1B9

PSMC3 monoclonal antibody (M01), clone 1B9