PSMC3 purified MaxPab mouse polyclonal antibody (B01P)
  • PSMC3 purified MaxPab mouse polyclonal antibody (B01P)

PSMC3 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00005702-B01P
PSMC3 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PSMC3 protein.
Información adicional
Size 50 ug
Gene Name PSMC3
Gene Alias MGC8487|TBP1
Gene Description proteasome (prosome, macropain) 26S subunit, ATPase, 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MNLLPNIESPVTRQEKMATVWDEAEQDGIGEEVLKMSTEEIIQRTRLLDSEIKIMKSEVLRVTHELQAMKDKIKENSEKIKVNKTLPYLVSNVIELLDVDPNDQEEDGANIDLDSQRKGKCAVIKTSTRQTYFLPVIGLVDAEKLKPGDLVGVNKDSYLILETLPTEYDSRVKAMEVDERPTEQYSDIGGLDKQIQELVEAIVLPMNHKEKFENLGIQPPKGVLMYGPPGTGKTLLARACAAQTKATFLKLAGPQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PSMC3 (NP_002795.2, 1 a.a. ~ 439 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5702

Enviar uma mensagem


PSMC3 purified MaxPab mouse polyclonal antibody (B01P)

PSMC3 purified MaxPab mouse polyclonal antibody (B01P)