PSMB9 polyclonal antibody (A01)
  • PSMB9 polyclonal antibody (A01)

PSMB9 polyclonal antibody (A01)

Ref: AB-H00005698-A01
PSMB9 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant PSMB9.
Información adicional
Size 50 uL
Gene Name PSMB9
Gene Alias LMP2|MGC70470|PSMB6i|RING12|beta1i
Gene Description proteasome (prosome, macropain) subunit, beta type, 9 (large multifunctional peptidase 2)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MLRAGAPTGDLPRAGEVHTGTTIMAVEFDGGVVMGSDSRVSAGEAVVNRVFDKLSPLHERIYCALSGSAADAQAVADMAAYQLELHGIELEEPPLVLAAANVVRNISYKYREDLSAHLMVAGWDQREGGQVYGTLGGMLTRQPFAIGGSGSTFIYGYVDAAYKPGMSPEECRRFTTDAIALAMSRDGSSGGVIYLVTITAAGVDHRVILGNELPKFYDE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PSMB9 (AAH65513, 1 a.a. ~ 219 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5698

Enviar uma mensagem


PSMB9 polyclonal antibody (A01)

PSMB9 polyclonal antibody (A01)