PSMB8 purified MaxPab rabbit polyclonal antibody (D01P)
  • PSMB8 purified MaxPab rabbit polyclonal antibody (D01P)

PSMB8 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00005696-D01P
PSMB8 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PSMB8 protein.
Información adicional
Size 100 ug
Gene Name PSMB8
Gene Alias D6S216|D6S216E|LMP7|MGC1491|PSMB5i|RING10|beta5i
Gene Description proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctional peptidase 7)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MLIGTPTPRDTTPSSWLTSSLLVEAAPLDDTTLPTPVSSGCPGLEPTEFFQSLGGDGERNVQIEMAHGTTTLAFKFQHGVIAAVDSRASAGSYISALRVNKVIEINPYLLGTMSGCAADCQYWERLLAKECRLYYLRNGERISVSAASKLLSNMMCQYRGMGLSMGSMICGWDKKGPGLYYVDEHGTRLSGNMFSTGSGNTYAYGVMDSGYRPNLSPEEAYDLGRRAIAYATHRDSYSGGVVNMYHMKEDGWVKV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PSMB8 (NP_004150.1, 1 a.a. ~ 272 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5696

Enviar uma mensagem


PSMB8 purified MaxPab rabbit polyclonal antibody (D01P)

PSMB8 purified MaxPab rabbit polyclonal antibody (D01P)