PSMB4 purified MaxPab rabbit polyclonal antibody (D01P)
  • PSMB4 purified MaxPab rabbit polyclonal antibody (D01P)

PSMB4 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00005692-D01P
PSMB4 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PSMB4 protein.
Información adicional
Size 100 ug
Gene Name PSMB4
Gene Alias HN3|HsN3|PROS26
Gene Description proteasome (prosome, macropain) subunit, beta type, 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr
Immunogen Prot. Seq MEAFLGSRSGLWAGGPAPGQFYRIPSTPDSFMDPASALYRGPITRTQNPMVTGTSVLGVKFEGGVVIAADMLGSYGSLARFRNISRIMRVNNSTMLGASGDYADFQYLKQVLGQMVIDEELLGDGHSYSPRAIHSWLTRAMYSRRSKMNPLWNTMVIGGYADGESFLGYVDMLGVAYEAPSLATGYGAYLAQPLLREVLEKQPVLSQTEARDLVERCMRVLYYRDARSYNRFQIATVTEKGVEIEGPLSTETNWD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PSMB4 (NP_002787.2, 1 a.a. ~ 264 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5692

Enviar uma mensagem


PSMB4 purified MaxPab rabbit polyclonal antibody (D01P)

PSMB4 purified MaxPab rabbit polyclonal antibody (D01P)