PSMB2 monoclonal antibody (M02), clone M1
  • PSMB2 monoclonal antibody (M02), clone M1

PSMB2 monoclonal antibody (M02), clone M1

Ref: AB-H00005690-M02
PSMB2 monoclonal antibody (M02), clone M1

Información del producto

Mouse monoclonal antibody raised against a full length recombinant PSMB2.
Información adicional
Size 100 ug
Gene Name PSMB2
Gene Alias HC7-I|MGC104215|MGC126885
Gene Description proteasome (prosome, macropain) subunit, beta type, 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRIIDKNGIHDLDNISFPKQGS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PSMB2 (AAH00268, 1 a.a. ~ 201 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5690
Clone Number M1
Iso type IgG1 Kappa

Enviar uma mensagem


PSMB2 monoclonal antibody (M02), clone M1

PSMB2 monoclonal antibody (M02), clone M1