PSG6 MaxPab mouse polyclonal antibody (B01P)
  • PSG6 MaxPab mouse polyclonal antibody (B01P)

PSG6 MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00005675-B01P
PSG6 MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PSG6 protein.
Información adicional
Size 50 ug
Gene Name PSG6
Gene Alias PSG10
Gene Description pregnancy specific beta-1-glycoprotein 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGPLSAPPCTQHITWKGLLLTASLLNFWNLPTTAQVIIEAKPPKVSEGKDVLLLVHNLPQNLTGYIWYKGQMTDLYHYITSYVVHGQIIYGPAYSGRETVYSNASLLIQNVTQEDAGSYTLHIIKRGDGTGGVTGYFTVTLYSETPKPSISSSNLNPREVMEAVRLICDPETPDASYLWLLNGQNLPMTHRLQLSKTNRTLYLFGVTKYIAGPYECEIRNPVSASRSDPVTLNLLPKLPMPYITINNLNPREKKD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PSG6 (NP_001027020, 1 a.a. ~ 424 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5675

Enviar uma mensagem


PSG6 MaxPab mouse polyclonal antibody (B01P)

PSG6 MaxPab mouse polyclonal antibody (B01P)