PSG4 purified MaxPab mouse polyclonal antibody (B01P)
  • PSG4 purified MaxPab mouse polyclonal antibody (B01P)

PSG4 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00005672-B01P
PSG4 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PSG4 protein.
Información adicional
Size 50 ug
Gene Name PSG4
Gene Alias PSG9
Gene Description pregnancy specific beta-1-glycoprotein 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGPLSAPPCTHLITWKGVLLTASLLNFWNPPTTAQVTIEAQPPKVSEGKDVLLLVHNLPQNLAGYIWYKGQMTYLYHYITSYVVDGQRIIYGPAYSGRERVYSNASLLIQNVTQEDAGSYTLHIIKRRDGTGGVTGHFTFTLHLETPKPSISSSNLNPREAMEAVILTCDPATPAASYQWWMNGQSLPMTHRLQLSKTNRTLFIFGVTKYIAGPYECEIRNPVSASRSDPVTLNLLPKLPKPYITINNLNPRENK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PSG4 (AAH63127, 1 a.a. ~ 419 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5672

Enviar uma mensagem


PSG4 purified MaxPab mouse polyclonal antibody (B01P)

PSG4 purified MaxPab mouse polyclonal antibody (B01P)