PSD purified MaxPab mouse polyclonal antibody (B01P)
  • PSD purified MaxPab mouse polyclonal antibody (B01P)

PSD purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00005662-B01P
PSD purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PSD protein.
Información adicional
Size 50 ug
Gene Name PSD
Gene Alias KIAA2011|PSD1|TYL
Gene Description pleckstrin and Sec7 domain containing
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IF
Immunogen Prot. Seq MAQGAMRFCSEGDCAISPPRCPRRWLPEGPVPQSPPASMYGSTGSLLRRVAGPGPRGRELGRVTAPCTPLRGPPSPRVAPSPWAPSSPTGQPPPGAQSSVVIFRFVEKASVRPLNGLPAPGGLSRSWDLGGVSPPRPTPALGPGSNRKLRLEASTSDPLPARGGSALPGSRNLVHGPPAPPQVGADGLYSSLPNGLGGPPERLATLFGGPADTGFLNQGDTWSSPREVSSHAQRIARAKWEFFYGSLDPPSSGAK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PSD (NP_002770.3, 1 a.a. ~ 1024 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5662

Enviar uma mensagem


PSD purified MaxPab mouse polyclonal antibody (B01P)

PSD purified MaxPab mouse polyclonal antibody (B01P)