PRTN3 purified MaxPab mouse polyclonal antibody (B01P)
  • PRTN3 purified MaxPab mouse polyclonal antibody (B01P)

PRTN3 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00005657-B01P
PRTN3 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PRTN3 protein.
Información adicional
Size 50 ug
Gene Name PRTN3
Gene Alias ACPA|AGP7|C-ANCA|MBT|P29|PR-3
Gene Description proteinase 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MAHRPPSPALASVLLALLLSGAARAAEIVGGHEAQPHSRPYMASLQMRGNPGSHFCGGTLIHPSFVLTAAHCLRDIPQRLVNVVLGAHNVRTQEPTQQHFSVAQVFLNNYDAENKLNDILLIQLSSPANLSASVATVQLPQQDQPVPHGTQCLAMGWGRVGAHDPPAQVLQELNVTVVTFFCRPHNICTFVPRRKAGICFGDSGGPLICDGIIQGIDSFVIWGCATRLFPDFFTRVALYVDWIRSTLRRVEAKGR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PRTN3 (AAH96184.1, 1 a.a. ~ 256 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5657

Enviar uma mensagem


PRTN3 purified MaxPab mouse polyclonal antibody (B01P)

PRTN3 purified MaxPab mouse polyclonal antibody (B01P)