KLK10 polyclonal antibody (A01)
  • KLK10 polyclonal antibody (A01)

KLK10 polyclonal antibody (A01)

Ref: AB-H00005655-A01
KLK10 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant KLK10.
Información adicional
Size 50 uL
Gene Name KLK10
Gene Alias NES1|PRSSL1
Gene Description kallikrein-related peptidase 10
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq DQCQVAGWGTTAARRVKYNKGLTCSSITILSPKECEVFYPGVVTNNMICAGLDRGQDPCQSDSGGPLVCDETLQGILSWGVYPCGSAQHPAVYTQICKYMSWINKVIRSN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen KLK10 (NP_002767, 167 a.a. ~ 276 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5655

Enviar uma mensagem


KLK10 polyclonal antibody (A01)

KLK10 polyclonal antibody (A01)