KLK7 purified MaxPab rabbit polyclonal antibody (D01P)
  • KLK7 purified MaxPab rabbit polyclonal antibody (D01P)

KLK7 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00005650-D01P
KLK7 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human KLK7 protein.
Información adicional
Size 100 ug
Gene Name KLK7
Gene Alias PRSS6|SCCE
Gene Description kallikrein-related peptidase 7
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MARSLLLPLQILLLSLALETAGEEAQGDKIIDGAPCARGSHPWQVALLSGNQLHCGGVLVNERWVLTAAHCKMNEYTVHLGSDTLGDRRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNSQARLSSMVKKVRLPSRCEPPGTTCTVSGWGTTTSPDVTFPSDLMCVDVKLISPQDCTKVYKDLLENSMLCAGIPDSKKNACNGDSGGPLVCRGTLQGLVSWGTFPCGQPNDPGVYTQVCKFTKWINDTMKKHR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen KLK7 (NP_005037.1, 1 a.a. ~ 253 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5650

Enviar uma mensagem


KLK7 purified MaxPab rabbit polyclonal antibody (D01P)

KLK7 purified MaxPab rabbit polyclonal antibody (D01P)