PRSS2 purified MaxPab rabbit polyclonal antibody (D01P)
  • PRSS2 purified MaxPab rabbit polyclonal antibody (D01P)

PRSS2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00005645-D01P
PRSS2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PRSS2 protein.
Información adicional
Size 100 ug
Gene Name PRSS2
Gene Alias MGC111183|MGC120174|TRY2|TRY8|TRYP2
Gene Description protease, serine, 2 (trypsin 2)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MNLLLILTFVAAAVAAPFDDDDKIVGGYICEENSVPYQVSLNSGYHFCGGSLISEQWVVSAGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPKYNSRTLDNDILLIKLSSPAVINSRVSAISLPTAPPAAGTESLISGWGNTLSSGADYPDELQCLDAPVLSQAECEASYPGKITNNMFCVGFLEGGKDSCQGDSGGPVVSNGELQGIVSWGYGCAQKNRPGVYTKVYNYVDWIKDTIAANS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PRSS2 (NP_002761.1, 1 a.a. ~ 247 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5645

Enviar uma mensagem


PRSS2 purified MaxPab rabbit polyclonal antibody (D01P)

PRSS2 purified MaxPab rabbit polyclonal antibody (D01P)