PRSS2 MaxPab mouse polyclonal antibody (B02)
  • PRSS2 MaxPab mouse polyclonal antibody (B02)

PRSS2 MaxPab mouse polyclonal antibody (B02)

Ref: AB-H00005645-B02
PRSS2 MaxPab mouse polyclonal antibody (B02)

Información del producto

Mouse polyclonal antibody raised against a full-length human PRSS2 protein.
Información adicional
Size 50 uL
Gene Name PRSS2
Gene Alias MGC111183|MGC120174|TRY2|TRY8|TRYP2
Gene Description protease, serine, 2 (trypsin 2)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MNLLLILTFVAAAVAAPFDDDDKIVGGYICEENSVPYQVSLNSGYHFCGGSLISEQWVVSAGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPKYNSRTLDNDILLIKLSSPAVINSRVSAISLPTAPPAAGTESLISGWGNTLSSGADYPDELQCLDAPVLSQAECEASYPGKITNNMFCVGFLEGGKDSCQGDSGGPVVSNGELQGIVSWGYGCAQKNRPGVYTKVYNYVDWIKDTIAANS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PRSS2 (NP_002761, 1 a.a. ~ 247 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 5645

Enviar uma mensagem


PRSS2 MaxPab mouse polyclonal antibody (B02)

PRSS2 MaxPab mouse polyclonal antibody (B02)