PRPSAP1 monoclonal antibody (M01), clone 5H10
  • PRPSAP1 monoclonal antibody (M01), clone 5H10

PRPSAP1 monoclonal antibody (M01), clone 5H10

Ref: AB-H00005635-M01
PRPSAP1 monoclonal antibody (M01), clone 5H10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PRPSAP1.
Información adicional
Size 100 ug
Gene Name PRPSAP1
Gene Alias PAP39
Gene Description phosphoribosyl pyrophosphate synthetase-associated protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq AKSPDAAKRAQSYAERLRLGLAVIHGEAQCTELDMDDGRHSPPMVKNATVHPGLELPLMMAKEKPPITVVGDVGGRIAIIVDDIIDDVESFV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PRPSAP1 (AAH09012.1, 175 a.a. ~ 266 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5635
Clone Number 5H10
Iso type IgG1 Kappa

Enviar uma mensagem


PRPSAP1 monoclonal antibody (M01), clone 5H10

PRPSAP1 monoclonal antibody (M01), clone 5H10