PROX1 monoclonal antibody (M02), clone 1E7
  • PROX1 monoclonal antibody (M02), clone 1E7

PROX1 monoclonal antibody (M02), clone 1E7

Ref: AB-H00005629-M02
PROX1 monoclonal antibody (M02), clone 1E7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PROX1.
Información adicional
Size 100 ug
Gene Name PROX1
Gene Alias -
Gene Description prospero homeobox 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq YARQAINDGVTSTEELSITRDCELYRALNMHYNKANDFEVPERFLEVAQITLREFFNAIIAGKDVDPSWKKAIYKVICKLDSEVPEIFKSPNCLQELLHE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PROX1 (NP_002754.2, 638 a.a. ~ 737 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5629
Clone Number 1E7
Iso type IgG2b Kappa

Enviar uma mensagem


PROX1 monoclonal antibody (M02), clone 1E7

PROX1 monoclonal antibody (M02), clone 1E7