PROS1 monoclonal antibody (M01), clone 3D7
  • PROS1 monoclonal antibody (M01), clone 3D7

PROS1 monoclonal antibody (M01), clone 3D7

Ref: AB-H00005627-M01
PROS1 monoclonal antibody (M01), clone 3D7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PROS1.
Información adicional
Size 100 ug
Gene Name PROS1
Gene Alias PROS|PS21|PS22|PS23|PS24|PS25|PSA
Gene Description protein S (alpha)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq GLLETKVYFAGFPRKVESELIKPINPRLDGCIRSWNLMKQGASGIKEIIQEKQNKHCLVTVEKGSYYPGSGIAQFHIDYNNVSSAEGWHVNVTLNIRP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PROS1 (NP_000304, 419 a.a. ~ 516 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5627
Clone Number 3D7
Iso type IgG2b Kappa

Enviar uma mensagem


PROS1 monoclonal antibody (M01), clone 3D7

PROS1 monoclonal antibody (M01), clone 3D7