PROC monoclonal antibody (M01), clone 3A10
  • PROC monoclonal antibody (M01), clone 3A10

PROC monoclonal antibody (M01), clone 3A10

Ref: AB-H00005624-M01
PROC monoclonal antibody (M01), clone 3A10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PROC.
Información adicional
Size 100 ug
Gene Name PROC
Gene Alias PC|PROC1
Gene Description protein C (inactivator of coagulation factors Va and VIIIa)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,WB-Re,IP,ELISA
Immunogen Prot. Seq RAHQVLRIRKRANSFLEELRHSSLERECIEEICDFEEAKEIFQNVDDTLAFWSKHVDGDQCLVLPLEHPCASLCCGHGTCIDGIGSFSCDCRSGWEGRFC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PROC (AAH34377, 32 a.a. ~ 131 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5624
Clone Number 3A10
Iso type IgG1 Kappa

Enviar uma mensagem


PROC monoclonal antibody (M01), clone 3A10

PROC monoclonal antibody (M01), clone 3A10