PROC purified MaxPab rabbit polyclonal antibody (D01P)
  • PROC purified MaxPab rabbit polyclonal antibody (D01P)

PROC purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00005624-D01P
PROC purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PROC protein.
Información adicional
Size 100 ug
Gene Name PROC
Gene Alias PC|PROC1
Gene Description protein C (inactivator of coagulation factors Va and VIIIa)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MWQLTSLLLFVATWGISGTPAPLDSVFSSSERAHQVLRIRKRANSFLEELRHSSLERECIEEICDFEEAKEIFQNVDDTLAFWSKHVDGDQCLVLPLEHPCASLCCGHGTCIDGIGSFSCDCRSGWEGRFCQREVSFLNCSLDNGGCTHYCLEEVGWRRCSCAPGYKLGDDLLQCHPAVKFPCGRPWKRMEKKRSHLKRDTEDQEDQVDPRLIDGKMTRRGDSPWQVVLLDSKKKLACGAVLIHPSWVLTAAHCM
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PROC (NP_000303.1, 1 a.a. ~ 461 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5624

Enviar uma mensagem


PROC purified MaxPab rabbit polyclonal antibody (D01P)

PROC purified MaxPab rabbit polyclonal antibody (D01P)