PRLR MaxPab mouse polyclonal antibody (B01P)
  • PRLR MaxPab mouse polyclonal antibody (B01P)

PRLR MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00005618-B01P
PRLR MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PRLR protein.
Información adicional
Size 50 ug
Gene Name PRLR
Gene Alias hPRLrI
Gene Description prolactin receptor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MKENVASATVFTLLLFLNTCLLNGQLPPGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHREGETLMHECPDYITGGPNSCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVDVTYIVQPDPPLELAVEVKQPEDRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEIHFAGQQTEFKILSLHPGQKYLVQVRCKPDHGYWSAWSPATFIQIPSDFTMNDTTVWISVAVLSAVICLIIVWA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PRLR (NP_000940, 1 a.a. ~ 622 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5618

Enviar uma mensagem


PRLR MaxPab mouse polyclonal antibody (B01P)

PRLR MaxPab mouse polyclonal antibody (B01P)