PRL monoclonal antibody (M07), clone 3F34
  • PRL monoclonal antibody (M07), clone 3F34

PRL monoclonal antibody (M07), clone 3F34

Ref: AB-H00005617-M07
PRL monoclonal antibody (M07), clone 3F34

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant PRL.
Información adicional
Size 100 ug
Gene Name PRL
Gene Alias -
Gene Description prolactin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LPICPGGAARCQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PRL (AAH15850, 29 a.a. ~ 227 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5617
Clone Number 3F34
Iso type IgG2a Kappa

Enviar uma mensagem


PRL monoclonal antibody (M07), clone 3F34

PRL monoclonal antibody (M07), clone 3F34