PRKX monoclonal antibody (M01), clone 1H7
  • PRKX monoclonal antibody (M01), clone 1H7

PRKX monoclonal antibody (M01), clone 1H7

Ref: AB-H00005613-M01
PRKX monoclonal antibody (M01), clone 1H7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PRKX.
Información adicional
Size 100 ug
Gene Name PRKX
Gene Alias PKX1
Gene Description protein kinase, X-linked
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IP,S-ELISA,ELISA
Immunogen Prot. Seq FHVKDLIKKLLVVDRTRRLGNMKNGANDVKHHRWFRSVDWEAVPQRKLKPPIVPKIAGDGDTSNFETYPENDWDTAAPVPQKDLEIFKNF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PRKX (AAH41073, 269 a.a. ~ 358 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5613
Clone Number 1H7
Iso type IgG2a Kappa

Enviar uma mensagem


PRKX monoclonal antibody (M01), clone 1H7

PRKX monoclonal antibody (M01), clone 1H7