PRKRIR purified MaxPab mouse polyclonal antibody (B01P)
  • PRKRIR purified MaxPab mouse polyclonal antibody (B01P)

PRKRIR purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00005612-B01P
PRKRIR purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PRKRIR protein.
Información adicional
Size 50 ug
Gene Name PRKRIR
Gene Alias DAP4|MGC102750|P52rIPK
Gene Description protein-kinase, interferon-inducible double stranded RNA dependent inhibitor, repressor of (P58 repressor)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IF
Immunogen Prot. Seq MGQLKFNTSEEHHADMYRSDLPNPDTLSAELHCWRIKWKHRGKDIELPSTIYEALHLPDIKFFPNVYALLKVLCILPVMKVENERYENGRKRLKAYLRNTLTDQRSSNLALLNINFDIKHDLDLMVDTYIKLYTSKSELPTDNSETVENT
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PRKRIR (AAH21992.1, 1 a.a. ~ 150 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5612

Enviar uma mensagem


PRKRIR purified MaxPab mouse polyclonal antibody (B01P)

PRKRIR purified MaxPab mouse polyclonal antibody (B01P)