DNAJC3 polyclonal antibody (A01)
  • DNAJC3 polyclonal antibody (A01)

DNAJC3 polyclonal antibody (A01)

Ref: AB-H00005611-A01
DNAJC3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant DNAJC3.
Información adicional
Size 50 uL
Gene Name DNAJC3
Gene Alias HP58|P58|P58IPK|PRKRI
Gene Description DnaJ (Hsp40) homolog, subfamily C, member 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MVAPGSVTSRLGSVFPFLLVLVDLQYEGAECGVNADVEKHLELGKKLLAAGQLADALSQFHAAVDGDPDNYIAYYRRATVFLAMGKSKAALPDLTKVIQLKMDFTAARLQRGHLLLKQGKLDEAEDDFKKVVFPVPSLLGLQRSLLDDLYLLFWFFLMKKVTFRCLSSAISECLPQSLNLMKFNLLISFLLLWTVRLVSCLRSIHYAVGSKTFLISSKSFMVLCFIFKPIVYLS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DNAJC3 (AAH33823, 1 a.a. ~ 234 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5611

Enviar uma mensagem


DNAJC3 polyclonal antibody (A01)

DNAJC3 polyclonal antibody (A01)