View larger
Mouse monoclonal antibody raised against a partial recombinant MAPK13.
AB-H00005603-M03
New product
MAPK13 monoclonal antibody (M03), clone 1E11
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | MAPK13 |
| Gene Alias | MGC99536|PRKM13|SAPK4|p38delta |
| Gene Description | mitogen-activated protein kinase 13 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA,IF |
| Immunogen Prot. Seq | NDKAAKSYIQSLPQTPRKDFTQLFPRASPQAADLLEKMLELDVDRRLTAAQALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVDEWKQHIYKEIVNFSPIARKDSRRRSGMKL |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | MAPK13 (AAH00433, 251 a.a. ~ 365 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 5603 |
| Clone Number | 1E11 |
| Iso type | IgG1 Kappa |
More info
Mouse monoclonal antibody raised against a partial recombinant MAPK13.