MAPK13 monoclonal antibody (M02), clone 2D8
  • MAPK13 monoclonal antibody (M02), clone 2D8

MAPK13 monoclonal antibody (M02), clone 2D8

Ref: AB-H00005603-M02
MAPK13 monoclonal antibody (M02), clone 2D8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MAPK13.
Información adicional
Size 100 ug
Gene Name MAPK13
Gene Alias MGC99536|PRKM13|SAPK4|p38delta
Gene Description mitogen-activated protein kinase 13
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq NDKAAKSYIQSLPQTPRKDFTQLFPRASPQAADLLEKMLELDVDRRLTAAQALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVDEWKQHIYKEIVNFSPIARKDSRRRSGMKL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MAPK13 (AAH00433, 251 a.a. ~ 365 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5603
Clone Number 2D8
Iso type IgG2b Kappa

Enviar uma mensagem


MAPK13 monoclonal antibody (M02), clone 2D8

MAPK13 monoclonal antibody (M02), clone 2D8