MAPK10 monoclonal antibody (M05), clone 3B9
  • MAPK10 monoclonal antibody (M05), clone 3B9

MAPK10 monoclonal antibody (M05), clone 3B9

Ref: AB-H00005602-M05
MAPK10 monoclonal antibody (M05), clone 3B9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MAPK10.
Información adicional
Size 100 ug
Gene Name MAPK10
Gene Alias FLJ12099|FLJ33785|JNK3|JNK3A|MGC50974|PRKM10|p493F12|p54bSAPK
Gene Description mitogen-activated protein kinase 10
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq DPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNSEEKTKNGVVKGQPSPSGAAVNSSESLPPSSSVNDISSMSTDQTLASDTDSSLEASAGPLGCCR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MAPK10 (AAH65516, 219 a.a. ~ 319 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5602
Clone Number 3B9
Iso type IgG1 Kappa

Enviar uma mensagem


MAPK10 monoclonal antibody (M05), clone 3B9

MAPK10 monoclonal antibody (M05), clone 3B9