MAPK11 monoclonal antibody (M03), clone 1F9
  • MAPK11 monoclonal antibody (M03), clone 1F9

MAPK11 monoclonal antibody (M03), clone 1F9

Ref: AB-H00005600-M03
MAPK11 monoclonal antibody (M03), clone 1F9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MAPK11.
Información adicional
Size 100 ug
Gene Name MAPK11
Gene Alias P38B|P38BETA2|PRKM11|SAPK2|SAPK2B|p38-2|p38Beta
Gene Description mitogen-activated protein kinase 11
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA,RNAi-Ab
Immunogen Prot. Seq ARTYIQSLPPMPQKDLSSIFRGANPLAIDLLGRMLVLDSDQRVSAAEALAHAYFSQYHDPEDEPEAEPYDESVEAKERTLEEWKELTYQEVLSFKPPEPPKPPGSLEIEQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MAPK11 (AAH27933, 255 a.a. ~ 364 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5600
Clone Number 1F9
Iso type IgG2a Kappa

Enviar uma mensagem


MAPK11 monoclonal antibody (M03), clone 1F9

MAPK11 monoclonal antibody (M03), clone 1F9