MAPK11 purified MaxPab mouse polyclonal antibody (B01P)
  • MAPK11 purified MaxPab mouse polyclonal antibody (B01P)

MAPK11 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00005600-B01P
MAPK11 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human MAPK11 protein.
Información adicional
Size 50 ug
Gene Name MAPK11
Gene Alias P38B|P38BETA2|PRKM11|SAPK2|SAPK2B|p38-2|p38Beta
Gene Description mitogen-activated protein kinase 11
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MSGPRAGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQSLIHARRTYRELRLLKHLKHENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNNIVKCQALSDEHVQFLVYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADEEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGSDYIDQLKRIMEVVGTPSPEVLAKISSEHA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MAPK11 (NP_002742.3, 1 a.a. ~ 364 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5600

Enviar uma mensagem


MAPK11 purified MaxPab mouse polyclonal antibody (B01P)

MAPK11 purified MaxPab mouse polyclonal antibody (B01P)