MAPK6 monoclonal antibody (M02), clone 4C11
  • MAPK6 monoclonal antibody (M02), clone 4C11

MAPK6 monoclonal antibody (M02), clone 4C11

Ref: AB-H00005597-M02
MAPK6 monoclonal antibody (M02), clone 4C11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MAPK6.
Información adicional
Size 50 ug
Gene Name MAPK6
Gene Alias DKFZp686F03189|ERK3|HsT17250|PRKM6|p97MAPK
Gene Description mitogen-activated protein kinase 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq EVRKDEQVEKENTYTSYLDKFFSRKEDTEMLETEPVEDGKLGERGHEEGFLNNSGEFLFNKQLESIGIPQFHSPVGSPLKSIQATLTPSAMKSSPQIPHQTYSSILKHLN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MAPK6 (AAH35492, 612 a.a. ~ 721 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5597
Clone Number 4C11
Iso type IgG2b Kappa

Enviar uma mensagem


MAPK6 monoclonal antibody (M02), clone 4C11

MAPK6 monoclonal antibody (M02), clone 4C11