MAPK4 polyclonal antibody (A01)
  • MAPK4 polyclonal antibody (A01)

MAPK4 polyclonal antibody (A01)

Ref: AB-H00005596-A01
MAPK4 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant MAPK4.
Información adicional
Size 50 uL
Gene Name MAPK4
Gene Alias ERK3|Erk4|PRKM4|p63MAPK
Gene Description mitogen-activated protein kinase 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq ACRKVAVKKIALSDARSMKHALREIKIIRRLDHDNIVKVYEVLGPKGTDLQGELFKFSVAYIVQEYMETDLARLLEQGTLAEEHAKLFMYQLLRGLKYIHSANVLHRDLK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MAPK4 (NP_002738, 42 a.a. ~ 151 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5596

Enviar uma mensagem


MAPK4 polyclonal antibody (A01)

MAPK4 polyclonal antibody (A01)