MAPK1 monoclonal antibody (M01A), clone 1D1
  • MAPK1 monoclonal antibody (M01A), clone 1D1

MAPK1 monoclonal antibody (M01A), clone 1D1

Ref: AB-H00005594-M01A
MAPK1 monoclonal antibody (M01A), clone 1D1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MAPK1.
Información adicional
Size 200 uL
Gene Name MAPK1
Gene Alias ERK|ERK2|ERT1|MAPK2|P42MAPK|PRKM1|PRKM2|p38|p40|p41|p41mapk
Gene Description mitogen-activated protein kinase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq RNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MAPK1 (AAH17832, 261 a.a. ~ 360 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 5594
Clone Number 1D1
Iso type IgG1 Kappa

Enviar uma mensagem


MAPK1 monoclonal antibody (M01A), clone 1D1

MAPK1 monoclonal antibody (M01A), clone 1D1