PRKG2 polyclonal antibody (A01)
  • PRKG2 polyclonal antibody (A01)

PRKG2 polyclonal antibody (A01)

Ref: AB-H00005593-A01
PRKG2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PRKG2.
Información adicional
Size 50 uL
Gene Name PRKG2
Gene Alias PRKGR2|cGKII
Gene Description protein kinase, cGMP-dependent, type II
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MGNGSVKPKHSKHPDGHSGNLTTDALRNKVTELERELRRKDAEIQEREYHLKELREQLSKQTVAIAELTEELQNKCIQLNKLQDVVHMQGGSPLQASPDK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PRKG2 (NP_006250, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5593

Enviar uma mensagem


PRKG2 polyclonal antibody (A01)

PRKG2 polyclonal antibody (A01)