PRKG1 monoclonal antibody (M03), clone 2B3
  • PRKG1 monoclonal antibody (M03), clone 2B3

PRKG1 monoclonal antibody (M03), clone 2B3

Ref: AB-H00005592-M03
PRKG1 monoclonal antibody (M03), clone 2B3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PRKG1.
Información adicional
Size 100 ug
Gene Name PRKG1
Gene Alias CGKI|DKFZp686K042|FLJ36117|MGC71944|PGK|PKG|PRKG1B|PRKGR1B|cGKI-BETA|cGKI-alpha
Gene Description protein kinase, cGMP-dependent, type I
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq RTKRQAISAEPTAFDIQDLSHVTLPFYPKSPQSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PRKG1 (NP_006249, 73 a.a. ~ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5592
Clone Number 2B3
Iso type IgG1 Kappa

Enviar uma mensagem


PRKG1 monoclonal antibody (M03), clone 2B3

PRKG1 monoclonal antibody (M03), clone 2B3